
❄️Lyophilized powder (not reconstituted)
Size:
Discount per Quantity
| Quantity | Discount | Price per Unit |
|---|---|---|
| 5 - 10 | 10% | €71.10 |
| 11 - 20 | 15% | €67.15 |
| 21+ | 20% | €63.20 |
Rigorous third-party testing
Every batch of our research chemicals and peptides undergoes independent third-party laboratory testing for purity and identity.
Total: €79.00
Tesamorelin is supplied as a catalogued research material in 5 mg and 10 mg.
Tesamorelin is a 44-residue human GRF analogue bearing an N-(trans-3-hexenoyl) group and C-terminal amide. Drug substance is commonly handled as a multi-acetate material, so acetate stoichiometry, N-acylation and intact mass must be verified for the supplied batch [1–3].
| Property | Value |
|---|---|
| Name and synonyms | Egrifta, TH9507 |
| Material category | Growth Hormone-Releasing Hormone (GHRH) Analog |
| Sequence | (trans-3-Hexenoyl)-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-OH |
| Molecular formula | C221H366N72O67S |
| Average molecular mass | 5135.78 g/mol |
| CAS Registry Number | 218949-48-5 |
| PubChem CID | CID 16137919 |
| Structural features | A 44-amino acid synthetic analog of human growth hormone-releasing hormone (GHRH) with a trans-3-hexenoyl group attached to the N-terminal tyrosine. This modification protects the peptide from DPP-4 degradation. |
| Appearance | White to off-white lyophilised powder |
| Solubility | Reconstitute with sterile or bacteriostatic water for injection. |
| Physical form | Catalogue vial; exact salt/counter-ion and excipients are batch-specific and must be verified in the CoA and SDS. |
Registry values apply only to the specific molecular entity, sequence, termini and material form. Batch records take precedence over family-level literature identifiers.
Tesamorelin is a stabilized GHRH analog that stimulates the synthesis and release of endogenous growth hormone. It is approved for the reduction of excess abdominal fat in HIV-infected patients with lipodystrophy.
Defined contexts include human GHRH-receptor binding and signalling, N-acylation structure–activity comparison, intact-mass and counter-ion analysis, and analytical separation from shorter GRF fragments [1–3].
Regulatory and clinical documents describe separately manufactured medicinal material and do not authenticate this catalogue batch. They must not be converted into human-use, efficacy, safety or dosing claims.
Tesamorelin is an approved medicinal active substance in some jurisdictions.
| Aspect | This catalogue material | Comparator |
|---|---|---|
| Identity | Tesamorelin: N-hexenoylated human GRF(1–44)-NH₂ | Sermorelin: unacylated human GRF(1–29)-NH₂ |
| Structural distinction | 44 residues plus an N-(trans-3-hexenoyl) group | Shorter 29-residue unacylated fragment |
| Analytical implication | Confirm complete 44-residue sequence, N-acyl group, amide and acetate content | Distinct intact mass, retention and impurity reference |
Quality information is batch- and presentation-specific. Use only the report linked to the exact size and lot. A report listed for another size, lot or similarly named material must not be treated as evidence for this product.
Chromatographic area purity, identity, net peptide or analyte content, water or counter-ion content, sterility, endotoxin and elemental impurities are different measurements. One result does not establish the others. Only tests supported by a visible, matching report should be regarded as available.
Store and handle only under the conditions stated on the product label, batch CoA and SDS. Keep the container secured, correctly identified and protected from contamination. Do not infer storage, solvent compatibility or stability from a related compound.
Laboratory preparation, analytical-method selection, risk assessment, personal protective equipment and waste disposal should follow the applicable SDS and the institution's approved procedures.
| Research-use notice | This material is supplied exclusively for laboratory research by qualified professionals and is not intended for human or veterinary use. Purchasers are responsible for compliance with applicable local requirements. |
Only when the exact sequence or structure, termini, conjugation, salt or counter-ion and hydration state match. The batch CoA and SDS govern; a related-compound identifier must not be substituted.
It is method- and report-specific. For example, an HPLC area percentage is not automatically the same as identity, net content, sterility, endotoxin status or absence of elemental impurities.
Follow the exact label, batch CoA and SDS together with the institution's risk assessment. Use only storage and stability information linked to the exact material form and batch.